Protein Info for PGA1_c10040 in Phaeobacter inhibens DSM 17395

Annotation: NAD(P) transhydrogenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 50 (18 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details PF02233: PNTB" amino acids 7 to 473 (467 residues), 618.7 bits, see alignment E=3.6e-190

Best Hits

KEGG orthology group: K00325, NAD(P) transhydrogenase subunit beta [EC: 1.6.1.2] (inferred from 90% identity to sil:SPO2819)

Predicted SEED Role

"NAD(P) transhydrogenase subunit beta (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVC4 at UniProt or InterPro

Protein Sequence (477 amino acids)

>PGA1_c10040 NAD(P) transhydrogenase subunit beta (Phaeobacter inhibens DSM 17395)
MDFGFTTAAYVVAAVLFILSLGGLSGQESAKRAVWYGIAGMALAVLATLIGPGAGLWLLS
IILIAAGGIIGYYVAKRVQMTEMPQLVAAMHSLVGLAAVFVGFIAHIELGRVLAMDDTAK
KALEGFGALLAKKDGVEIAILRVELFLGVFIGAVTFTGSVIAYGKLAGKVSSAATKLPGG
HMLNAGAAGLSLICLIWYFNTGGFFPLFLMTLAALFIGYHLIMGIGGADMPVVVSMLNSY
SGWAAAAIGFSLGNDLLIVVGALVGSSGAILSYIMCKAMNRSFVSVILGGFGGTAGPAME
IDGEQIAIDADGVAAALDEADSVVIIPGYGMAVAQAQQNVAELTRRLRAKGKNVRFAIHP
VAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFPETDVAIVIGSNDIVNPAAQEDPNSPI
AGMPVLECWKAKQVFVSKRGQGTGYSGIENPLFFKENTRMFYGDAKASLDKLLTMIS