Protein Info for PGA1_c09980 in Phaeobacter inhibens DSM 17395

Annotation: kynureninase KynU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 TIGR01814: kynureninase" amino acids 10 to 380 (371 residues), 293.8 bits, see alignment E=9.7e-92 PF00266: Aminotran_5" amino acids 99 to 334 (236 residues), 65.7 bits, see alignment E=3.9e-22 PF22580: KYNU_C" amino acids 289 to 376 (88 residues), 117.9 bits, see alignment E=1.5e-38

Best Hits

Swiss-Prot: 49% identical to KYNU_PSEFL: Kynureninase (kynU) from Pseudomonas fluorescens

KEGG orthology group: K01556, kynureninase [EC: 3.7.1.3] (inferred from 80% identity to sil:SPO2824)

MetaCyc: 49% identical to kynureninase subunit (Pseudomonas fluorescens)
Kynureninase. [EC: 3.7.1.3]

Predicted SEED Role

"Kynureninase (EC 3.7.1.3)" in subsystem NAD and NADP cofactor biosynthesis global (EC 3.7.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DNR4 at UniProt or InterPro

Protein Sequence (397 amino acids)

>PGA1_c09980 kynureninase KynU (Phaeobacter inhibens DSM 17395)
MTDFSATKAMFSLPEGMIYLDGNSLGPMPRATAERVRGTIEDEWGEMLITGWNKAGWMQK
PTAIGDRIARLIGAEPGHVVMGDTLSIKVYQAVASALELNPTRKVVLSDNGNFPSDLYMV
EGLVKSLGPDYSLRVVAPEEVSANLTDDIAVLMLTEVDYRTGRKHDMKALTEQAHAAGVV
TVWDLAHSAGALPVDLAGCKADFAVGCTYKYLNSGPGGPAFIYVAPRHAEKARPALSGWL
GHAAPFDFDLNYKPGNGIERMRVGTPPVLQLAALEASMDIWDMADMADVRAKSIELCDLF
ITEVESRCPDLTLASPRDGTVRGSQVSFRFHEGYAAMQALIARGVVGDFRSPDIMRFGFT
PLYIDQGDVRAAVDIIEDVITNALWDSAEYKTRNAVT