Protein Info for PGA1_c09970 in Phaeobacter inhibens DSM 17395

Annotation: tryptophan 2,3-dioxygenase KynA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF03301: Trp_dioxygenase" amino acids 13 to 277 (265 residues), 221.4 bits, see alignment E=1.1e-69 TIGR03036: tryptophan 2,3-dioxygenase" amino acids 15 to 277 (263 residues), 406.7 bits, see alignment E=2.2e-126

Best Hits

Swiss-Prot: 68% identical to T23O_BRADU: Tryptophan 2,3-dioxygenase (kynA) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00453, tryptophan 2,3-dioxygenase [EC: 1.13.11.11] (inferred from 73% identity to azl:AZL_c02120)

Predicted SEED Role

"Tryptophan 2,3-dioxygenase (EC 1.13.11.11)" in subsystem Aromatic amino acid degradation or NAD and NADP cofactor biosynthesis global (EC 1.13.11.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXW2 at UniProt or InterPro

Protein Sequence (277 amino acids)

>PGA1_c09970 tryptophan 2,3-dioxygenase KynA (Phaeobacter inhibens DSM 17395)
MSTPYDPAKEGAQMSFDGRMSYGDYLSLDLLLNAQKTWTNTHDEMLFIIQHQTSELWMRL
AIHELTAARSRLLANKPHEAFKMLARVARIFEQLNSAWDVLRTMTPSDYSAFRDELGQSS
GFQSHQYRQIEFMLGNRNKAMLRPHAHRPDVLALLEDELSQPSLYDVALKTLGQRFDLPK
EVLNRNLSEAYTPHPAVEAAWSEVYRNTEAHWDLYELAEKLVDFEDYFRRWRFNHVTTVE
RVIGFKRGTGGTGGVSYLKRMLEVELFPELWHLRTAL