Protein Info for Psest_1010 in Pseudomonas stutzeri RCH2

Annotation: Predicted integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 76 to 100 (25 residues), see Phobius details amino acids 120 to 145 (26 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 274 to 299 (26 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 15 to 291 (277 residues), 47.5 bits, see alignment E=8.6e-17

Best Hits

KEGG orthology group: K07027, (no description) (inferred from 89% identity to psa:PST_3283)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJU1 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Psest_1010 Predicted integral membrane protein (Pseudomonas stutzeri RCH2)
MKRSDVAWTLIGISAVLLSGYLLYHEVRNISLAELTDSLHAIVPVGWLLAALSTLGAYVA
LAWYDRIAVAHLGKRISWWFIALCSFTTYALAHNIGASVFSGALVRYRAYRSKGLTPQEI
GILIVFCSLTFALGVLLTAGVVLILKPQLLDRIVHSARWVSFAAGSGLLVLIALYVFGAW
RQLAPWRLGKWHIEYPRLPIVGRQLLAGPLELLCAAAIIYFALPAENNPGYLTILGVFLA
SFSLALLSHAPGGLGVLELTFLAALPELPTVDVLAALIVFRGFYLLLPFALAILIVLAFE
HGQWRERRAAMQRR