Protein Info for PGA1_c09950 in Phaeobacter inhibens DSM 17395

Annotation: isoquinoline 1-oxidoreductase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 6 to 64 (59 residues), 36.6 bits, E=3.6e-13
• PF01799: Fer2_2
  • amino acids 72 to 145 (74 residues), 104.1 bits, E=3.3e-34

Best Hits

Swiss-Prot: 63% identical to IORA_BREDI: Isoquinoline 1-oxidoreductase subunit alpha (iorA) from Brevundimonas diminuta

KEGG orthology group: K07302, isoquinoline 1-oxidoreductase, alpha subunit [EC: 1.3.99.16] (inferred from 84% identity to sil:SPO2826)

MetaCyc: 63% identical to isoquinoline 1-oxidoreductase subunit alpha (Brevundimonas diminuta)
Isoquinoline 1-oxidoreductase. [EC: 1.3.99.16]

Predicted SEED Role

"Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.16

Use Curated BLAST to search for 1.3.99.16

Sequence Analysis Tools

See I7EKH8 at UniProt or InterPro

Protein Sequence (154 amino acids)

>PGA1_c09950 isoquinoline 1-oxidoreductase subunit alpha (Phaeobacter inhibens DSM 17395)
MSTTLRINGTPHEVDLPDDVPLLWVLRDEIGLTGTKFGCGVAACGACTVHIDGEAVRSCQ
VALSDVWGDVTTIEGVGTPNTMVVVQKAWVANQVAQCGYCQSGQIMQAASLLAENPSPSD
AEIDEAMQGNLCRCGTYPRIRAAIHDAASMMKEA