Protein Info for HP15_950 in Marinobacter adhaerens HP15

Annotation: RNA polymerase, sigma-24 subunit, ECF subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 42 to 200 (159 residues), 91.2 bits, see alignment E=2.8e-30 PF04542: Sigma70_r2" amino acids 46 to 112 (67 residues), 63.3 bits, see alignment E=1.5e-21 PF08281: Sigma70_r4_2" amino acids 145 to 196 (52 residues), 48.9 bits, see alignment E=4e-17

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 57% identity to csa:Csal_1098)

Predicted SEED Role

"RNA polymerase sigma-70 factor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PF09 at UniProt or InterPro

Protein Sequence (202 amino acids)

>HP15_950 RNA polymerase, sigma-24 subunit, ECF subfamily (Marinobacter adhaerens HP15)
MKPDPDQLPDNANDAQSFQAPPDTPERIAELIHRVAQKDRQAFALLYQATAPKLLGTVLR
ILRDKGWADDVIQDSYLKIWQKAEQFQDGKSSPITWLVSIARNGAIDELRKHPAGRTTNS
DELDEMPGWQTSAQEQLEDQRAATQLNHCIDQLEKDRQDMVRLAYLNGWSREDLASQFEQ
PVNTVKTWLHRALKQLKRCLES