Protein Info for HP15_944 in Marinobacter adhaerens HP15

Annotation: FAD dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF01946: Thi4" amino acids 9 to 58 (50 residues), 27.5 bits, see alignment 5.4e-10 PF01494: FAD_binding_3" amino acids 10 to 42 (33 residues), 28.2 bits, see alignment (E = 3.5e-10) PF01266: DAO" amino acids 12 to 360 (349 residues), 248.4 bits, see alignment E=4.8e-77 PF00890: FAD_binding_2" amino acids 12 to 62 (51 residues), 23.6 bits, see alignment 8.4e-09 PF13450: NAD_binding_8" amino acids 15 to 52 (38 residues), 26.6 bits, see alignment 1.8e-09

Best Hits

Swiss-Prot: 63% identical to PUUB_ECOLI: Gamma-glutamylputrescine oxidoreductase (puuB) from Escherichia coli (strain K12)

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 69% identity to pmk:MDS_2926)

MetaCyc: 63% identical to gamma-glutamylputrescine oxidase (Escherichia coli K-12 substr. MG1655)
1.4.3.M3 [EC: 1.4.3.M3]

Predicted SEED Role

"Gamma-glutamyl-putrescine oxidase (EC1.4.3.-)"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.- or 1.4.3.M3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PF03 at UniProt or InterPro

Protein Sequence (408 amino acids)

>HP15_944 FAD dependent oxidoreductase (Marinobacter adhaerens HP15)
MRPALRGSCEADVCVVGAGYTGLSTALFLAEAGFRVVVLEAATVGWGASGRNGGQIVNSF
SRDLDSIERQTSQDHLKLLSEMAFEGSQIIRQRVKSYGIRCDLKEGGIFAALNPKQLRHL
ESQQALWRRFGYDQLELLDRNAIRSRVGTERYVGGAIDHTGGHIHPLNLALGEAAALESR
GGVIHEHSTVTSIAPGKTVTVRTDMGEVRAQTVVLAGNAYLGGLVPELGAKSMPCGSQII
ATEPLEEAVARQLLPNDNCVEDCNYLLDYFRLSGDNRLIYGGGVVYGARDPANIERLIRP
NMLKTFPQLANVKIDYAWTGNFLLTLSRLPQLGRLHENVFYSQGCSGHGVTFTHVAGKAL
GLAIQDQAERFDAFASLPHYPFPGGRAFRVPLTAMGAWYYALRDRLGV