Protein Info for Psest_0994 in Pseudomonas stutzeri RCH2
Annotation: L-aspartate-alpha-decarboxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to PAND_PSEU5: Aspartate 1-decarboxylase (panD) from Pseudomonas stutzeri (strain A1501)
KEGG orthology group: K01579, aspartate 1-decarboxylase [EC: 4.1.1.11] (inferred from 98% identity to psa:PST_3298)MetaCyc: 57% identical to aspartate 1-decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Aspartate 1-decarboxylase (EC 4.1.1.11)" in subsystem Coenzyme A Biosynthesis (EC 4.1.1.11)
MetaCyc Pathways
- superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
- β-alanine biosynthesis III (1/1 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.1.11
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GFR4 at UniProt or InterPro
Protein Sequence (126 amino acids)
>Psest_0994 L-aspartate-alpha-decarboxylase (Pseudomonas stutzeri RCH2) MHAIMLKAKLHRAQVTHSVLDYEGSCAIDGEWLDLAGIREYEQIQIYNVDNGERFTTYAI RGEEGSKIISVNGAAAHKAGVGHRVIICAYAHYSEAELANFKPHVLYMGADGELSHTSNA IPVQVA