Protein Info for Psest_0994 in Pseudomonas stutzeri RCH2

Annotation: L-aspartate-alpha-decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 TIGR00223: aspartate 1-decarboxylase" amino acids 1 to 126 (126 residues), 151.3 bits, see alignment E=5.9e-49 PF02261: Asp_decarbox" amino acids 1 to 111 (111 residues), 148.1 bits, see alignment E=4.8e-48

Best Hits

Swiss-Prot: 98% identical to PAND_PSEU5: Aspartate 1-decarboxylase (panD) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01579, aspartate 1-decarboxylase [EC: 4.1.1.11] (inferred from 98% identity to psa:PST_3298)

MetaCyc: 57% identical to aspartate 1-decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Aspartate 1-decarboxylase (EC 4.1.1.11)" in subsystem Coenzyme A Biosynthesis (EC 4.1.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFR4 at UniProt or InterPro

Protein Sequence (126 amino acids)

>Psest_0994 L-aspartate-alpha-decarboxylase (Pseudomonas stutzeri RCH2)
MHAIMLKAKLHRAQVTHSVLDYEGSCAIDGEWLDLAGIREYEQIQIYNVDNGERFTTYAI
RGEEGSKIISVNGAAAHKAGVGHRVIICAYAHYSEAELANFKPHVLYMGADGELSHTSNA
IPVQVA