Protein Info for PGA1_c09730 in Phaeobacter inhibens DSM 17395

Annotation: putative voltage-gated CIC-type chloride channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 181 to 205 (25 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 251 to 278 (28 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details amino acids 324 to 351 (28 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 391 to 416 (26 residues), see Phobius details amino acids 422 to 443 (22 residues), see Phobius details PF00654: Voltage_CLC" amino acids 94 to 439 (346 residues), 278 bits, see alignment E=6e-87

Best Hits

KEGG orthology group: None (inferred from 77% identity to sil:SPO1208)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVA3 at UniProt or InterPro

Protein Sequence (563 amino acids)

>PGA1_c09730 putative voltage-gated CIC-type chloride channel (Phaeobacter inhibens DSM 17395)
MPQTIRSVISAQFTQGVAGARDVWRVLRHRGPSQIQFWFIALLIGIAAGFAALFFRKGIT
AFQAWVYGTEDVNFLHSFAQGMPWYWLVAIPTVGGLLVGVILHRFTPDARVRSVADVIEG
AALGDGRVEMRAGLASACASFITLSTGGSTGREGPVVHMAGVISTWVSNRIQADGITGRD
LLGCAVAAAVSASFNAPIAGALFALEVVLRHFAVHAFAPIVIASVAGTVINRLEYGDVTE
FDLITPGALQFYVELPAFLMLGLICGLVAVVLMRSIFFAEQIGNALQDRLQLPRWLRPAA
SGLLLGVIAVWFPHIIGVGYETTVLALTGALVLHQTILFAMVKTAAVAITMGGRMGGGVF
SPSLMVGALTGLAFGLIATAVLPDVSGTHTLYAFAGMGAVAAAVLGAPISTTLIVFELTG
DWQIGLAVMVAVSMSTALASRIVDRSFFLTQLERRNIHCAAGPQAYLLSMLRAGAVMRPM
GDPRCASAEDCAALIEQGLSIRASASLEAAMPIFDRAELAYLPVLAEAEGGDNPPNLIGA
LYHIDSLKAYNRALAAAAAEEHS