Protein Info for Psest_0981 in Pseudomonas stutzeri RCH2

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 833 PF04760: IF2_N" amino acids 1 to 51 (51 residues), 32.6 bits, see alignment 2.3e-11 amino acids 258 to 308 (51 residues), 57.7 bits, see alignment 3.2e-19 PF08364: IF2_assoc" amino acids 61 to 95 (35 residues), 41 bits, see alignment (E = 7.2e-14) TIGR00487: translation initiation factor IF-2" amino acids 252 to 832 (581 residues), 873.6 bits, see alignment E=7.8e-267 TIGR00231: small GTP-binding protein domain" amino acids 336 to 492 (157 residues), 108.8 bits, see alignment E=2.4e-35 PF00009: GTP_EFTU" amino acids 337 to 493 (157 residues), 126.3 bits, see alignment E=4.5e-40 PF01926: MMR_HSR1" amino acids 338 to 443 (106 residues), 42.9 bits, see alignment E=2e-14 PF22042: EF-G_D2" amino acids 510 to 588 (79 residues), 106.9 bits, see alignment E=1.8e-34 PF11987: IF-2" amino acids 609 to 723 (115 residues), 133.6 bits, see alignment E=1.3e-42

Best Hits

Swiss-Prot: 96% identical to IF2_PSEU5: Translation initiation factor IF-2 (infB) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 96% identity to psa:PST_3310)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHU1 at UniProt or InterPro

Protein Sequence (833 amino acids)

>Psest_0981 translation initiation factor IF-2 (Pseudomonas stutzeri RCH2)
MTQVTVKELAQVVDTPVERLLQQMREAGLSHTSAEQVVTDNEKQALLAHLKSTHGAKVDE
PRKITLQRKTTTKLKVGGSKTISVEVRKKKTFVKRSAEEIEAEQRRELEEQRAAEEAARL
KAEQEARARAEEEARRKAESNQPQADVTAPAAVEPVVNAEPTPAAVEPAAPAPERKKEEP
RRVEKPRSDDDERRDRKHAQHRPSLKTKAPLARTVRTGEDEADGFRRGGRGKSKLKKRNQ
HGFQSPTGPVVREVSIGETITVAELAQQMSVKAAEVIKFMFKMGSPVTINQVLDQETAQL
VAEELGHKVKLVSDNALEEQLAELLKFEGESVSRAPVVTVMGHVDHGKTSLLDYIRRAKV
AVGEAGGITQHIGAYHVETERGMVTFLDTPGHAAFTAMRARGAKATDIVILVVAADDGVM
PQTQEAVQHAKAAGVPIVVAVNKIDKPDANPDNIKNGLGALDVIPEEWGGDTPFIPVSAK
MGTGVDELLEAVLLQAELLELKATPSAPGRGVVVESRLDKGRGPVATVLVQDGTLRQGDM
VLCGVNFGRVRAMLDENGKPVKEAGPSIPVEILGLDGTPEAGDDLTVVADEKKAREVALF
RQGKFREVKLARAHAGKLENIFETMGQDEKKTLNIVLKADVRGSLEALQGSLNGLGNDEV
QVRVVGGGVGGITESDANLALASNAVLFGFNVRADAGARKIVEAEGLDMRYYNVIYDIIE
DVKKALTGMLGSDVRENILGIAEVRDVFRSPKFGAIAGCMVTEGMVHRNRPIRVLRDDVV
IFEGELESLRRFKDDVAEVRAGMECGIGVKSYNDVKVGDKIEVFEKVEVARSL