Protein Info for HP15_930 in Marinobacter adhaerens HP15

Annotation: branched-chain amino acid transport permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 54 to 80 (27 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 224 to 247 (24 residues), see Phobius details amino acids 261 to 286 (26 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 48 to 310 (263 residues), 123.4 bits, see alignment E=4.9e-40

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 66% identity to psa:PST_3204)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PEY9 at UniProt or InterPro

Protein Sequence (331 amino acids)

>HP15_930 branched-chain amino acid transport permease (Marinobacter adhaerens HP15)
MNQPVNSADIHKAIVQEQAAQDRKKMMLNGVLLLLLLAAPFMIYPVFLMKILCFALFAVA
FNLLFGFTGLLSFGHAAFLATGGYTTGYLLSNYSGLSTEMGIIAGTLAATVLGTGFALLS
IRRQGIYFAMVTLALAQLVFFFFVQSEFTGGEDGMHGIPRGELLGFINLEDNLNMYYFVL
AVFIACYLLVQRIVGSPFGQVLKAIKQNEPRAVSLGYNVDRYKVLAFVISAALAGLAGSM
KSVVFQLASLNDAHWHMSGEVILMTLVGGMGTLLGPVVGATFVVNIEYQLSQGALRDWVD
PILGGIFVLTVLAFRSGIVGEIQKFVKKNLG