Protein Info for HP15_95 in Marinobacter adhaerens HP15

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details PF01545: Cation_efflux" amino acids 1 to 168 (168 residues), 139.9 bits, see alignment E=9.7e-45 TIGR01297: cation diffusion facilitator family transporter" amino acids 1 to 249 (249 residues), 204.2 bits, see alignment E=1.3e-64 PF16916: ZT_dimer" amino acids 174 to 247 (74 residues), 33.6 bits, see alignment E=3.3e-12

Best Hits

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 97% identity to maq:Maqu_3275)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJ40 at UniProt or InterPro

Protein Sequence (262 amino acids)

>HP15_95 cation diffusion facilitator family transporter (Marinobacter adhaerens HP15)
MALIADAIHNFSDMASLFIAFAARKIARRPADSKMTFGYGRIEIVAALINYTTLIMIGAY
LIYEGGMRFLDPPEIKGWWVVWLGIIALVVDGLTALLTYSMQKDSVNIRALFLHNLSDAF
ASIAVVVGGALILLYDMRWVDPAITIGIASYILYLGLTEIGGTIRTLMLGSPVDIDTDSV
IEALSNVEGVLDLHHVHFWQMGEHDASLDAHVVVEISAWNELEKVKGRIKRTLDNEFSIT
HSTLEFEHPDHSHKDAHTYGHG