Protein Info for HP15_920 in Marinobacter adhaerens HP15

Annotation: protein belonging to uncharacterized protein family UPF0118

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 48 to 70 (23 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details amino acids 283 to 309 (27 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 353 to 382 (30 residues), see Phobius details PF01594: AI-2E_transport" amino acids 64 to 386 (323 residues), 158.8 bits, see alignment E=1e-50

Best Hits

KEGG orthology group: None (inferred from 81% identity to maq:Maqu_2143)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PEX9 at UniProt or InterPro

Protein Sequence (398 amino acids)

>HP15_920 protein belonging to uncharacterized protein family UPF0118 (Marinobacter adhaerens HP15)
MRSRHGEGRLTVFNTGLEFPGQLFSRYTGFIMEDQSTNKEPTGENKRLLISSDLATPIYG
LFGLGILYTLYVAHQIVLPIILAVMTSLLLSPLVKKAYVKWRVPRMISSLVFVLLVLAGI
VGITLAVATPALKWVEEVPQGISRLLVGESEISRQIARVSESAEQVEKSVEELSESERQQ
PTTVVLQTDSWRNQLMTKARNGIAGLALALALTYFLLVSGDRLIKNFVRQLPIDQRKTVL
RITHDSQHQIAQYLGVLGLSNLAVGTTTGLICWAVGLPDPAVWGLVAGLARFIPYLGVIL
SISMLTIVSAISLDEFWMMAIAPLGFLGLTTLVGFFIEPWIHGFRMAINPVIIFVSIFFW
GWLWGPVGVLLAVPLMTVIQVVLKQIPKLRPVYKVIAR