Protein Info for PGA1_c09560 in Phaeobacter inhibens DSM 17395

Annotation: UDP-N-acetylmuramoylalanine--D-glutamate ligase MurD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 82% identical to MURD_RUEST: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 82% identity to sit:TM1040_0679)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXS3 at UniProt or InterPro

Protein Sequence (465 amino acids)

>PGA1_c09560 UDP-N-acetylmuramoylalanine--D-glutamate ligase MurD (Phaeobacter inhibens DSM 17395)
MIPVTGFEGAKVAVLGLGRSGFATARALREGGAEPVCWDDNPGARARAEVEGFVCRDLQK
AGAFDDIASLVVSPGIPHLYPKPNPVIHAALVAGVPVDNDIGLFFRSVATRGWERFDQAP
RIVAVTGSNGKSTTVALLHHILQEAGRESQLAGNIGRGVLDIDPPGSGGIVVLELSSYQT
DLARALTPDVAVFTNLSPDHLDRHAGMGGYFAAKRRLFAEGGPDRAIIGVDEDEGLYLAG
QLSEAASDDRVIRISASQKLTGLGWQVFARKGFLSEYRKGRQAASIDLRQMQGLPGAHNH
QNACAAYAAARALGLAPRLIEDALASYPGLPHRSQTIATHAGVRYVNDSKATNLDSAVKA
LSAFDNIRWICGGLEKDGGLEALRGQTGKVRKAYVIGREAAGFAMQLDVEAEVCITMAEA
VARASAEAETGDTVLLAPAAASFDQYDNFEQRGEDFIAEVAKLQG