Protein Info for Psest_0965 in Pseudomonas stutzeri RCH2

Annotation: chaperone protein DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 TIGR02349: chaperone protein DnaJ" amino acids 5 to 349 (345 residues), 455.4 bits, see alignment E=8.4e-141 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 97.7 bits, see alignment E=6.7e-32 PF01556: DnaJ_C" amino acids 121 to 334 (214 residues), 181.6 bits, see alignment E=2.1e-57 PF00684: DnaJ_CXXCXGXG" amino acids 148 to 208 (61 residues), 57.2 bits, see alignment E=3.4e-19 PF27439: DnaJ_C_2" amino acids 340 to 375 (36 residues), 30.9 bits, see alignment 4.5e-11

Best Hits

Swiss-Prot: 99% identical to DNAJ_PSEST: Chaperone protein DnaJ (dnaJ) from Pseudomonas stutzeri

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 99% identity to psa:PST_3326)

MetaCyc: 66% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFP0 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Psest_0965 chaperone protein DnaJ (Pseudomonas stutzeri RCH2)
MAKRDFYEVLGVERGVSEAELKKAYRRLAMKHHPDRNPGDKAAEEAFKEANEAYEVLSDP
SKRAAYDQYGHAGVDPQMGAGAAGAGYGGANFSDIFGDVFSDFFSGGRGGGRGGAQRGSD
LRYTLELDLEEAVRGTTVTIRVPTLVECKICDGSGAKKGTSPVTCTTCGGIGQVRMQQGF
FSVQQTCPRCHGSGKMISDPCGSCHGQGRVEEQKTLSVKVPPGVDTGDRIRLSGEGEAGT
QGGPAGDLYVVVNVREHAIFQRDGKHLYCEVPISFADAALGGELEVPTLDGRVKLKIPEG
TQTGKQFRLRGKGVAPVRGGAAGDLMCRVVVETPVNLSKRQREMLEEFRGTLQGDTSHSP
KASGWFEGVKRFFGDV