Protein Info for PGA1_c09480 in Phaeobacter inhibens DSM 17395

Annotation: putative protein MraZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 PF02381: MraZ" amino acids 31 to 58 (28 residues), 24 bits, see alignment 3.1e-09 amino acids 121 to 165 (45 residues), 36.9 bits, see alignment 2.9e-13

Best Hits

Swiss-Prot: 86% identical to MRAZ_RUEPO: Transcriptional regulator MraZ (mraZ) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K03925, MraZ protein (inferred from 86% identity to sil:SPO1178)

Predicted SEED Role

"Cell division protein MraZ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EV82 at UniProt or InterPro

Protein Sequence (193 amino acids)

>PGA1_c09480 putative protein MraZ (Phaeobacter inhibens DSM 17395)
MAADQPAPFASGDSFGTRDAEKRDDRLGRRFRGESHHKVDTKGRVSIPASFRRVLEAGDP
NWQSGSNPELVIVYGDQRRNFLECYTMEAIEEVDAKIDALPRGSMPRKMLQRMFHGQSFP
TNVDETGRLVLPAKLRNKIDLEAEAFFIAAGDTFQIWKPETYEEEELAKSEEWMDDLPED
FDPMELLDGAGGA