Protein Info for Psest_0960 in Pseudomonas stutzeri RCH2

Annotation: Small protein A (tmRNA-binding)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF04355: BamE" amino acids 35 to 100 (66 residues), 94.2 bits, see alignment E=1.7e-31

Best Hits

Swiss-Prot: 77% identical to BAME_PSEAE: Outer membrane protein assembly factor BamE (bamE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06186, small protein A (inferred from 94% identity to psa:PST_3331)

Predicted SEED Role

"Outer membrane lipoprotein SmpA, a component of the essential YaeT outer-membrane protein assembly complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFN5 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Psest_0960 Small protein A (tmRNA-binding) (Pseudomonas stutzeri RCH2)
MQNTKLMLTSLTLVGLFALAGCSFPGVYKVDIQQGNVVTQDMIDQLRPGMTRQQVRFIMG
NPLITDTFHANRWDYLYSIQPGGSQRQQERVSLVFNANDQLAGLAGDFMPGVSRDEQILG
RQPQGTSTTPAAVPRQPEERPAPGSLLEQIQREVDQAEPVPVPIPEPLETE