Protein Info for Psest_0093 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized enzyme of phosphonate metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06007: PhnJ
  • amino acids 12 to 283 (272 residues), 496.9 bits, E=6.1e-154

Best Hits

Swiss-Prot: 79% identical to PHNJ_ECOLI: Alpha-D-ribose 1-methylphosphonate 5-phosphate C-P lyase (phnJ) from Escherichia coli (strain K12)

KEGG orthology group: K06163, PhnJ protein (inferred from 91% identity to psb:Psyr_2254)

MetaCyc: 79% identical to carbon-phosphorus lyase core complex subunit PhnJ (Escherichia coli K-12 substr. MG1655)
RXN-17956 [EC: 4.7.1.1]; 4.7.1.1 [EC: 4.7.1.1]

Predicted SEED Role

"PhnJ protein" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

• methylphosphonate degradation I (4/5 steps found)
• (aminomethyl)phosphonate degradation (6/8 steps found)
• glyphosate degradation III (4/7 steps found)
• methylphosphonate degradation II (2/5 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.7.1.1

Sequence Analysis Tools

See L0GFA7 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Psest_0093 Uncharacterized enzyme of phosphonate metabolism (Pseudomonas stutzeri RCH2)
MNAHAIPASEAGYNFAYLDEQTKRMIRRALLKAVAIPGYQVPFGGREMPLPYGWGTGGMQ
LTAAILGADDVLKVIDQGADDTTNAVSIRRFFARTAGVATTERTPAATVIQTRHRIPETP
LAAGQIMVYQVPIPEPLRFIEPSETETRTMHALGDYGVMHVKLYEDIATFGHIATSYAYP
VTVDGRYVMDPSPIPKFDNPKLDRSPALMLFGAGREKRLYAVPPYTRVVSLDFEDHPFQI
QQWEQCCAICGSGDSYLDELIVDDAGSKQFVCSDTDYCAQRAQQQENRP