Protein Info for Psest_0954 in Pseudomonas stutzeri RCH2

Annotation: Fe-S oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 43% identical to LUTA_BACSU: Lactate utilization protein A (lutA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 97% identity to psa:PST_3337)

MetaCyc: 43% identical to iron-sulfur oxidase subunit used in L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE" in subsystem Lactate utilization

MetaCyc Pathways

Bifidobacterium shunt (15/15 steps found)
homolactic fermentation (11/12 steps found)
hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
heterolactic fermentation (15/18 steps found)
superpathway of glucose and xylose degradation (14/17 steps found)
superpathway of anaerobic sucrose degradation (15/19 steps found)
pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
pyruvate fermentation to (S)-lactate (1/1 steps found)
pyruvate fermentation to acetate and lactate II (3/4 steps found)
(S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GID3 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Psest_0954 Fe-S oxidoreductase (Pseudomonas stutzeri RCH2)
MSELFYDAAPNATRVAPPLPKPREYPAKPSQVYLFGTCVVDLFYPEAGLDAIRLLEREGL
TVHYPQGQTCCGQPAYTSGYTDEARNVARAQLDLFANDWPVVVPSGSCAGMLRHHYLDLF
KDDPATLKKAQALAERTFELAEFLLNVCKVEFKDAGTPTKVALHTSCSARREMNTHLHGR
ALLAQLGQVERVEHDHESECCGFGGTFSVRMPDISGAMVLDKTRALKESGAHQVISADCG
CLMNINGSLEKQREALRGQHLASFLWQRTGGAR