Protein Info for Psest_0946 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF20229: ChrB_N" amino acids 19 to 105 (87 residues), 24.5 bits, see alignment E=2.3e-09 PF09828: ChrB_C" amino acids 178 to 305 (128 residues), 150 bits, see alignment E=5e-48

Best Hits

Swiss-Prot: 45% identical to CHRB1_CUPMC: Protein ChrB (chrB1) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: None (inferred from 96% identity to pmy:Pmen_2248)

Predicted SEED Role

"Chromate resistance protein ChrB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJG9 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Psest_0946 Uncharacterized conserved protein (Pseudomonas stutzeri RCH2)
MINWLCLVMALPTANAAERMRAWRTLKSAGAAVLRDGVYLLPDGSASREVLESVERDVLD
SGGSASLLPVTDPQGERFIPLFDRGDDYTRLRSEVEPQLAQLTPENALATARQARKLRKS
FAQIQAIDFFPGAALQQADALLRDLEVAINRALSKDEPTSHEQIIEQLDPRDYQGRTWAT
RQRPWVDRLASAWLIRRFIDPGASILWLPSLDACPAEALGFDFDGAQFSHVGNKVTFETL
QASFGLEAPGLQRVGALVHYLDVGGAQPTEATGVERVLAGLRASIENDDQLLAAACAIFD
GLLAAFGKEGQSDE