Protein Info for Psest_0938 in Pseudomonas stutzeri RCH2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 63 to 87 (25 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 182 to 208 (27 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details PF13795: HupE_UreJ_2" amino acids 46 to 243 (198 residues), 227.8 bits, see alignment E=4.3e-72

Best Hits

KEGG orthology group: None (inferred from 98% identity to pmy:Pmen_2240)

Predicted SEED Role

"putative ORF1 [Plasmid pTOM9]"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIB8 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Psest_0938 hypothetical protein (Pseudomonas stutzeri RCH2)
MNSLPLSGATALIARLRRPLFLPLLAIALLMAVMPEALAHGVPEGDKGFIQESTGVMLMP
FIYMGAKHMITGYDHLLFLFGVIFFLYRLKDVGLYVTLFALGHSITLLFGVLSNISISSY
VIDAIIGFSVVYKALDNLGAFQRWFGYQPDTRAATLIFGLLHGFGLATKIQEFEISSDGL
IANLIAFNVGVEIGQLLALGGILILMGYWRRTASFWRHAYTANVAMMSAGFLLMGYQITG
LIVSQ