Protein Info for Psest_0931 in Pseudomonas stutzeri RCH2

Annotation: putative quinone oxidoreductase, YhdH/YhfP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 122 to 139 (18 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details TIGR02823: putative quinone oxidoreductase, YhdH/YhfP family" amino acids 3 to 325 (323 residues), 452.1 bits, see alignment E=4.4e-140 PF08240: ADH_N" amino acids 28 to 115 (88 residues), 45.6 bits, see alignment E=7.2e-16 PF00107: ADH_zinc_N" amino acids 159 to 276 (118 residues), 53.6 bits, see alignment E=2.3e-18

Best Hits

Swiss-Prot: 59% identical to ACUI_RHOS4: Acrylyl-CoA reductase AcuI (acuI) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: None (inferred from 76% identity to avn:Avin_18460)

MetaCyc: 53% identical to acrylyl-CoA reductase (Escherichia coli K-12 substr. MG1655)
RXN-9087 [EC: 1.3.1.84]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1 or 1.3.1.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIB5 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Psest_0931 putative quinone oxidoreductase, YhdH/YhfP family (Pseudomonas stutzeri RCH2)
MFKAILIEKNTDGYQAQLADLHDEQLPAGDVTVRVSYSTLNYKDGLAISGKSPVVRQFPM
IPGIDLAGTVEASNHPHYQVGDRVLLNGWGVGESHWGGLAQKARLRGDWLIPLPKGLSER
QAMAIGTAGYTAMLCLLALERHGLTPARGEVLVTGANGGVGSFAIALLARRGYQVIAATG
RIGETEYLKRLGAATVIDRNELSNPGRALAKERWAAAIDSVGSHTLANVCAGTHADGVVA
ACGLAQGMEFPATVAPFILRGVSLLGINSVTRSYKERVEAWERLCTDLDLSLLDQITHEI
GLSEAMPVVEQLLNGKVRGRVVVDVNR