Protein Info for Psest_0930 in Pseudomonas stutzeri RCH2
Annotation: Nitroreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 50% identical to NFSB_SALTY: Oxygen-insensitive NAD(P)H nitroreductase (nfsB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K10679, nitroreductase / dihydropteridine reductase [EC: 1.-.-.- 1.5.1.34] (inferred from 74% identity to pen:PSEEN2307)MetaCyc: 73% identical to type 1 nitroaromatic nitroreductase (Pseudomonas putida KT2440)
1.7.1.M3 [EC: 1.7.1.M3]; 1.7.1.M3 [EC: 1.7.1.M3]; 1.7.1.M3 [EC: 1.7.1.M3]; 1.7.1.M3 [EC: 1.7.1.M3]
Predicted SEED Role
"Oxygen-insensitive NAD(P)H nitroreductase (EC 1.-.-.-) / Dihydropteridine reductase (EC 1.5.1.34)" in subsystem Pterin biosynthesis (EC 1.-.-.-, EC 1.5.1.34)
MetaCyc Pathways
- L-phenylalanine degradation V (3/3 steps found)
- tetrahydropteridine recycling (2/2 steps found)
- roxarsone (and nitarsone) degradation IV (2/6 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Folate biosynthesis
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-, 1.5.1.34
Use Curated BLAST to search for 1.-.-.- or 1.5.1.34 or 1.7.1.M3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GHQ4 at UniProt or InterPro
Protein Sequence (217 amino acids)
>Psest_0930 Nitroreductase (Pseudomonas stutzeri RCH2) MELASLAKRRYTTKAFDASRKIPQASIDALLEQLRHSPSSVNSQPWHFVIASTDEGKARI AKGTEGSFAYNAPKVLKASHVIVLCSRNDMTEEHLQALLDQEARDGRFHSEDARVGQDNA RRGYVALHRYDQKDLQHWMEKQTYLALGTLLLGAAALGLDATPMEGFDFKKLDEELGLRA QGLTSLVLVALGYRDETDFNAGLPKSRLPAEQVFTHI