Protein Info for PGA1_c09100 in Phaeobacter inhibens DSM 17395

Annotation: putative thiamine biosynthesis oxidoreductase ThiO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01266: DAO" amino acids 2 to 308 (307 residues), 165.1 bits, see alignment E=6.7e-52 PF01134: GIDA" amino acids 2 to 84 (83 residues), 22.4 bits, see alignment E=1.2e-08 PF00890: FAD_binding_2" amino acids 4 to 55 (52 residues), 26.8 bits, see alignment 6.3e-10 PF13450: NAD_binding_8" amino acids 4 to 40 (37 residues), 32.7 bits, see alignment 1.5e-11

Best Hits

Swiss-Prot: 56% identical to THIO_RHIEC: Putative thiamine biosynthesis oxidoreductase ThiO (thiO) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K03153, glycine oxidase [EC: 1.4.3.19] (inferred from 56% identity to ret:RHE_PB00081)

Predicted SEED Role

"Glycine oxidase ThiO (EC 1.4.3.19)" in subsystem Thiamin biosynthesis (EC 1.4.3.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EKA3 at UniProt or InterPro

Protein Sequence (324 amino acids)

>PGA1_c09100 putative thiamine biosynthesis oxidoreductase ThiO (Phaeobacter inhibens DSM 17395)
MITIAGAGLAGLACAYELAQRGAAVRVYERATEIGAGSVSRYAGGMLAPWCERESAEEEV
ITLGGRAIDWWAKVTSIHRRGTLVVAPPRDRAEITRFARRTTQYRRVDGPEIAELEPALA
GRFSQALFFEQEAHLDPRRAVWDLAAAAAALGAEICLGTDAPGSVDLDCRGIAAAGQLPD
LRPVRGEMAILHCPEVEISRTLRLLHPRMPLYLVPRGDSLFMIGGTMIESTSTRAISLRS
LSELLNAAFTLHPGFAEASVVETGAGLRPAFPDNLPRLNQDGGTLFLNGLYRHGFLLAPA
MAQQVANRLRPETQDENHRQRQTA