Protein Info for PGA1_c09050 in Phaeobacter inhibens DSM 17395

Annotation: thiamine-phosphate pyrophosphorylase ThiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02581: TMP-TENI
  • amino acids 11 to 178 (168 residues), 156.3 bits, E=2.8e-50
• TIGR00693: thiamine-phosphate diphosphorylase
  • amino acids 11 to 190 (180 residues), 153.1 bits, E=2.9e-49

Best Hits

Swiss-Prot: 59% identical to THIE_RHIEC: Thiamine-phosphate synthase (thiE) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 73% identity to gox:GOX2228)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (8/11 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (2/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (2/3 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (1/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (1/2 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (4/7 steps found)
• thiamine diphosphate salvage V (1/3 steps found)
• superpathway of thiamine diphosphate biosynthesis I (6/10 steps found)
• thiamine diphosphate salvage II (2/5 steps found)
• thiamine diphosphate salvage IV (yeast) (3/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (3/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.3

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

See I7EXM8 at UniProt or InterPro

Protein Sequence (197 amino acids)

>PGA1_c09050 thiamine-phosphate pyrophosphorylase ThiE (Phaeobacter inhibens DSM 17395)
MERFYLIVGHVSQLELLVPHGVRLVQLRLKDLPEQEVRRQIARARDFCAVHGAQLVVNDH
WQAALDLNCGFVHLGQEDMDSADFAALRRKGVRFGLSTHDEAELERALAFEPDYIALGPV
YETLLKKMKWAPQGVDRVRRWKEMAGRTPLVAIGGLTPERLPGVFAAGADSAAVVTDILQ
ATDPEARTREWIKACAS