Protein Info for HP15_869 in Marinobacter adhaerens HP15

Annotation: lysine exporter protein (LYSE/YGGA)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 38 to 65 (28 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details PF01810: LysE" amino acids 16 to 198 (183 residues), 121.9 bits, see alignment E=1.3e-39

Best Hits

Swiss-Prot: 41% identical to YGGA_AERSA: Putative amino-acid transporter YggA (yggA) from Aeromonas salmonicida

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 76% identity to maq:Maqu_1338)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PR98 at UniProt or InterPro

Protein Sequence (201 amino acids)

>HP15_869 lysine exporter protein (LYSE/YGGA) (Marinobacter adhaerens HP15)
MLESYLTGLIVCGGIIVAIGAQNAYLLSQAIRREHHWWSAGLCIVADITLFTLGMFGISA
ALMAMPEALEILRWLGVAFLGWLAIQSFVRASRGRAALEAGEVTKRSLKAVVFTTLAVTL
LNPQVYLDTLLLIPAIGAQQEDATTFVAGASSASILWFGLLAWGGSALAPILSRPLAWRI
IDGVIGIMMAAIALHLTFSGL