Protein Info for PGA1_c09010 in Phaeobacter inhibens DSM 17395

Annotation: RNA polymerase sigma-32 factor RpoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 TIGR02392: alternative sigma factor RpoH" amino acids 15 to 286 (272 residues), 366.5 bits, see alignment E=9.5e-114 PF00140: Sigma70_r1_2" amino acids 17 to 43 (27 residues), 36.4 bits, see alignment (E = 6.3e-13) TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 50 to 285 (236 residues), 106.1 bits, see alignment E=1.5e-34 PF04542: Sigma70_r2" amino acids 53 to 121 (69 residues), 62.6 bits, see alignment E=3.6e-21 PF04545: Sigma70_r4" amino acids 232 to 283 (52 residues), 55.7 bits, see alignment 4.1e-19

Best Hits

Swiss-Prot: 69% identical to RPOH_CAUVC: RNA polymerase sigma factor RpoH (rpoH) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 91% identity to sil:SPO1409)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DNF6 at UniProt or InterPro

Protein Sequence (298 amino acids)

>PGA1_c09010 RNA polymerase sigma-32 factor RpoH (Phaeobacter inhibens DSM 17395)
MANYANLPAPTPEGGLNRYLQEIRKFPLLEPEEEYMLAKRWVEEQDSASAHKMVTSHLRL
AAKIAMGYRGYGLPQAEVISEANVGLMQAVKRFDPEKGFRLATYAMWWIRASIQEYILRS
WSLVKLGTTSAQKKLFFNLRKAKARIGALEEGDLHPDSVKKIATDLGVTETEVISMNRRM
SGGDASLNATVGSEGEGTMQWQDWLEDEDADQAGDYEARDELEARRELLASALEVLNDRE
KDILTQRRLADQAKTLEDLSTQYGVSRERIRQIEVRAFEKLQKKMRELASEKGMLSVQ