Protein Info for HP15_860 in Marinobacter adhaerens HP15

Annotation: transcriptional regulator, AsnC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF13404: HTH_AsnC-type" amino acids 6 to 47 (42 residues), 67.5 bits, see alignment E=1.4e-22 PF13412: HTH_24" amino acids 6 to 53 (48 residues), 74.4 bits, see alignment E=8.5e-25 PF08279: HTH_11" amino acids 11 to 51 (41 residues), 25.2 bits, see alignment E=2.5e-09 PF01037: AsnC_trans_reg" amino acids 72 to 146 (75 residues), 76.5 bits, see alignment E=2.3e-25

Best Hits

Swiss-Prot: 45% identical to BKDR_PSEAE: Bkd operon transcriptional regulator (bkdR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 65% identity to nve:NEMVE_v1g151547)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PR89 at UniProt or InterPro

Protein Sequence (159 amino acids)

>HP15_860 transcriptional regulator, AsnC family protein (Marinobacter adhaerens HP15)
MKQVELDKLDRKILSVLQQDGRISNQLLAEQVGLSPAACWRRVRTLEESGVIQGYSARVD
PERIGQGLCVLVNLSLQRHNIDSTAEIEQQVSSYPEVLQCFAVTGNADFVLRVIVPDMAS
YDRFLNEKIFTLQGIAQVNSNFALREIKNTETIPVEGIL