Protein Info for PGA1_c08900 in Phaeobacter inhibens DSM 17395

Annotation: putative capsule polysaccharide export protein KpsS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 PF05159: Capsule_synth" amino acids 80 to 389 (310 residues), 186.1 bits, see alignment E=5.6e-59

Best Hits

KEGG orthology group: K07265, capsular polysaccharide export protein (inferred from 77% identity to sit:TM1040_2132)

Predicted SEED Role

"Capsular polysaccharide export system protein KpsS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DNE6 at UniProt or InterPro

Protein Sequence (430 amino acids)

>PGA1_c08900 putative capsule polysaccharide export protein KpsS (Phaeobacter inhibens DSM 17395)
MHKTDDPQRAFLFLQGPHGPFFASLAEMLQAAGCAVWRVGFNAGDQAFWRDKSRYLPYRG
TPEDWPAHLEQVLGDHQITDLVLYGDTRPIHATAVSAARARGIRVHVFEEGYLRPYWVTY
EREGSNGHSRLMDMPVAEMTTALALSDMEAPLPPSHWGDTRQHVFYGALYHGFVMLLNRG
YRQFRPHRALPVTREFQLYLRRLLLMPFQALERRLATRRIRNGGFPYHLALLQLEHDSAF
QEHSPFASLTDFLTDVFQGFAEGAPRHHHLVVKAHPLEDGRVPIRRTVRQLAKRYGLEHR
VHYVRGGKLAALLNEARTAVTVNSTAGQQVLWRGIPLKVFGKAVYDKPEFVSTQPLAEFF
AAPARPDNRAYKDYRRYLLETSQLPGGFYSRKGRRQLLRQVVDMMLASEDPYQALMQGTA
APRQQLRVVS