Protein Info for HP15_855 in Marinobacter adhaerens HP15

Annotation: M23 peptidase domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 29 to 51 (23 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 87 to 112 (26 residues), see Phobius details PF01551: Peptidase_M23" amino acids 196 to 285 (90 residues), 47.6 bits, see alignment E=8.1e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PR84 at UniProt or InterPro

Protein Sequence (322 amino acids)

>HP15_855 M23 peptidase domain protein (Marinobacter adhaerens HP15)
MSLMVMLTQIVLPVVLLVWLARFPARGWLALGVQALSVAGVLVGLGLAALWVMPPFWVPY
LYYGGFLFIVVRHLWNGRFQRDGLWQVSAGQTLLVLLGFALGCLGGYMAYMAYQGRALPA
VETVDIAPPFGPGTYLVAHGGSNAMVNVHLKTLDTALERFRPWRGQSRALDIFRISPLGI
HKHGWLPSDPARYTTFGTPVLAPCDGEIAKVVDGLEDMPVPVMDREHMAGNYVAINCGQF
FVILAHLRKGSVSVSAGDRVDVGGFLGEMGNSGNSSEPHLHVHAQRGLPEQAAFGGEPLA
LTIDDAFPVRNDRIRVAVPVDR