Protein Info for Psest_0892 in Pseudomonas stutzeri RCH2

Annotation: Short-chain alcohol dehydrogenase of unknown specificity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00106: adh_short" amino acids 20 to 206 (187 residues), 186 bits, see alignment E=8.5e-59 PF08659: KR" amino acids 22 to 176 (155 residues), 59.8 bits, see alignment E=5e-20 PF13561: adh_short_C2" amino acids 26 to 237 (212 residues), 129.9 bits, see alignment E=1.7e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to bmj:BMULJ_05875)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJD0 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Psest_0892 Short-chain alcohol dehydrogenase of unknown specificity (Pseudomonas stutzeri RCH2)
MAKYKPADEVLSMSNNISGKVVVITGASSGLGEVTARHLAALGARVVLAARRKDKLDALV
AELTNAGGQAIAYQTDVTSQEEVKTLIQGAVDTYGRIDVLINNAGLMAIAPLSDTRTDEW
DRMIDINIKGLLYGVAAALPVFQKQNSGHFINIASVAGLKVFSPGGTVYSGTKFAVRAIS
EGLRHEVGGSIRTTTIEPGAVDSELKFGSTHQQSRDFVVDFYKHAIPAESVARAIAFAIE
QPADVDINEIVLRPTVQEF