Protein Info for Psest_0889 in Pseudomonas stutzeri RCH2

Annotation: Lactoylglutathione lyase and related lyases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF00903: Glyoxalase" amino acids 12 to 126 (115 residues), 30.6 bits, see alignment E=3.9e-11 PF18029: Glyoxalase_6" amino acids 15 to 127 (113 residues), 28.5 bits, see alignment E=2e-10

Best Hits

KEGG orthology group: None (inferred from 98% identity to bmu:Bmul_5632)

Predicted SEED Role

"Lactoylglutathione lyase and related lyases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI86 at UniProt or InterPro

Protein Sequence (132 amino acids)

>Psest_0889 Lactoylglutathione lyase and related lyases (Pseudomonas stutzeri RCH2)
MSTPVISGDGIFSHIFIGAADLQKSVAFYAAALGALGIKNLGPFNNGWVLFGREKPAFII
ARPGNGEAPSSNGVTIGFAAATPAEVDAFHAAGLAAGGTDEGQPGARGHLPGAYAAYLRD
PAGNKVCSYTFV