Protein Info for HP15_87 in Marinobacter adhaerens HP15

Annotation: disulfide oxidoreductase C BdbC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 114 to 138 (25 residues), see Phobius details PF02600: DsbB" amino acids 13 to 137 (125 residues), 35 bits, see alignment E=9.5e-13

Best Hits

Swiss-Prot: 72% identical to BDBC_PSERE: Probable disulfide formation protein from Pseudomonas resinovorans

KEGG orthology group: K03611, disulfide bond formation protein DsbB (inferred from 66% identity to psa:PST_0576)

Predicted SEED Role

"Probable disulfide formation protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIE6 at UniProt or InterPro

Protein Sequence (144 amino acids)

>HP15_87 disulfide oxidoreductase C BdbC (Marinobacter adhaerens HP15)
MTNNNQVIPWGLLLSAWLLALVSSLSAIYIGEVLGQAPCVLCWFQRAFMFPLAVILAVAC
YYSDFNVWRYAMPLAVIGSLFALAHSLLYVGIIPQPIQPCTATGPSCSGDGMTIFGGLPL
PFLSLAIFVAIIILLLLVRRRIHS