Protein Info for PGA1_c08770 in Phaeobacter inhibens DSM 17395

Annotation: putative sarcosine oxidase, subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: K00305, sarcosine oxidase, subunit gamma [EC: 1.5.3.1] (inferred from 65% identity to sit:TM1040_2144)

Predicted SEED Role

"Sarcosine oxidase gamma subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

• glycine betaine degradation I (7/8 steps found)
• creatinine degradation I (2/4 steps found)
• creatinine degradation II (1/5 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1

Sequence Analysis Tools

See I7EK70 at UniProt or InterPro

Protein Sequence (181 amino acids)

>PGA1_c08770 putative sarcosine oxidase, subunit gamma (Phaeobacter inhibens DSM 17395)
MVELRVKTPCAGLLPLEVGELSLTEAPGEGMTTLAPYAGQVAALSAALEAAHGLRWPTPN
RSHAKAGARIIWFGREMALLSGTRPDPALAEHAALTDQSDGWAVVRLEGAQGHAVLARLC
PVDLRPSVFKRGHTARCELKHMAASITRLGPKTLQIMVFRSMAETLVDDLKTAMEAVAAR
G