Protein Info for PGA1_c08750 in Phaeobacter inhibens DSM 17395

Annotation: sarcosine oxidase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 TIGR01373: sarcosine oxidase, beta subunit family" amino acids 2 to 406 (405 residues), 664.3 bits, see alignment E=3.2e-204 PF01266: DAO" amino acids 33 to 380 (348 residues), 231.6 bits, see alignment E=2.2e-72

Best Hits

Swiss-Prot: 70% identical to SOXB_RHIME: Sarcosine oxidase subunit beta (soxB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00303, sarcosine oxidase, subunit beta [EC: 1.5.3.1] (inferred from 85% identity to sit:TM1040_2147)

MetaCyc: 52% identical to sarcosine oxidase beta subunit (Corynebacterium sp.)
RXN-22742 [EC: 1.5.3.24]

Predicted SEED Role

"Sarcosine oxidase beta subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1 or 1.5.3.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXJ9 at UniProt or InterPro

Protein Sequence (417 amino acids)

>PGA1_c08750 sarcosine oxidase subunit beta (Phaeobacter inhibens DSM 17395)
MRFSGWRVLREGLTGNRGWQGHWRDPDPKPEYDAVIIGGGGHGLATAYYLARDHGMTNIA
VLERGYIGGGNVGRNTTIVRANYYLPGNSEFYSHSLKLWEGLEQDLNYNAMMSQRGILNV
FHNDAQRDSAVRRANAIINQGDDAEILSRDQLREMVPLLNYANNRFPIQGALLQRRAGTA
RHDAVAWGFARGADQRGVDILQNCEVTGIRTEGGKVIGVETSRGLIRAGKVAMAAAGRSS
QVAAMAGLTLPIESHVLQAFVSEGLKPIIDHVLTFAEGHLYISQSDKGGLVFGSYLDLYA
SYAARGNLPMVEHTMEACMAMLPAIGKARLLRSWGGIMDMTPDGSPIIDRTSIEGLYLNA
GWCYGGFKATPASGQCYAHLIATDRPHEAAAAFRLERFETGHGLMDEEATGAQHNLH