Protein Info for HP15_837 in Marinobacter adhaerens HP15

Annotation: iron-hydroxamate transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 48 to 70 (23 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 388 to 407 (20 residues), see Phobius details amino acids 419 to 438 (20 residues), see Phobius details amino acids 444 to 463 (20 residues), see Phobius details amino acids 474 to 499 (26 residues), see Phobius details amino acids 519 to 541 (23 residues), see Phobius details amino acids 562 to 589 (28 residues), see Phobius details amino acids 601 to 622 (22 residues), see Phobius details amino acids 632 to 651 (20 residues), see Phobius details PF01032: FecCD" amino acids 20 to 316 (297 residues), 203.5 bits, see alignment E=2.1e-64 amino acids 366 to 651 (286 residues), 220.3 bits, see alignment E=1.6e-69

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 78% identity to maq:Maqu_2190)

Predicted SEED Role

"Ferric hydroxamate ABC transporter (TC 3.A.1.14.3), permease component FhuB" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin (TC 3.A.1.14.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PR66 at UniProt or InterPro

Protein Sequence (656 amino acids)

>HP15_837 iron-hydroxamate transporter permease subunit (Marinobacter adhaerens HP15)
MAAALIWCGAFLASAAPWLGQLNPGALIAAFWTFEGSDYASVLAHYSWAPRVAIAVLIGF
GLGLAGAVTQQILGNPLASPTTLGVEAGGQFGITVATMFFPGLLAFSPDLVAVSGGLLAI
GLVIALTWRLGFSPVTVILAGLVVTFFLGAVNMAFLLLKGEWLGNLFIWGAGSLVQNNWQ
PFMELWPRVLVLGVFMVLLMRPLQIMQLGQTSARSLGAKVGLIRVLALFLVVLMSATVVS
RVGVVAFIGLAAPVLARLLGARTLSERLIWSSLLGAGLLLLADTLAHWASTRGDGSLVPT
GTTTALIGGPIILLALQSLKNTHHMPGQDDSPAGFLPKRRSIFLTAGGIAALLLATIVIS
MGWSPGLDEWSWTPTAQWHEAWVWRGPRLLAAILAGVALGLAGTLIQRMTGNPMASPEML
GISGGAAVVMVLIVLLGADIGRAGQLGAATLGAAAALGLLIMLARKHRFAGNQLLLGGLA
LYVFMDAGLRLVMASGGTVASQLLNWMYGSTWLVSEVEALGLLALIVLISAGLLVIIRPL
SILPLGETSASSLGLPVTKVRLMLLLLAALLTASATVVIGPLSFVGLIAPHLARVLGQQT
VGRQLVVAALAGGLLLGMADYLSRIVVYPNQLPAGLLAALVGGLYFLWGLSRHGRA