Protein Info for PGA1_c08650 in Phaeobacter inhibens DSM 17395

Annotation: homoserine dehydrogenase Hom

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03447: NAD_binding_3
  • amino acids 11 to 131 (121 residues), 63.8 bits, E=3.6e-21
• PF00742: Homoserine_dh
  • amino acids 139 to 316 (178 residues), 196.4 bits, E=5.1e-62
• PF01842: ACT
  • amino acids 349 to 412 (64 residues), 38.2 bits, E=1.5e-13

Best Hits

Swiss-Prot: 42% identical to DHOM_MYCTU: Homoserine dehydrogenase (hom) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00003, homoserine dehydrogenase [EC: 1.1.1.3] (inferred from 84% identity to sit:TM1040_2164)

Predicted SEED Role

"Homoserine dehydrogenase (EC 1.1.1.3)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 1.1.1.3)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of L-threonine biosynthesis (5/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.3

Sequence Analysis Tools

See I7EXI8 at UniProt or InterPro

Protein Sequence (428 amino acids)

>PGA1_c08650 homoserine dehydrogenase Hom (Phaeobacter inhibens DSM 17395)
MTEPLRLGIAGLGTVGTGVIKIIRRQAAMLEARTGRQIQITAVSARDASKDRGVPLGDYA
WETDPVALATRDDVDVFVELMGGHEGAAKAATEAALEAGKDVVTANKALLAIHGQALAEQ
AEAAGRVIRFEAAVAGGIPVIKSLTEGLAGNEITRVMGVMNGTCNYILTQMEATGQGYNA
LFEECGRLGYLEADPNLDVGGIDAGHKLAILSAIAFGTKPAFDDVQLEGIQRISLDDIRH
AADMGYRIKLLGVAQRTGRGLEQRMSPCLVPANSPLGQLEGGTNMVVIEGDAVEQIVLRG
PGAGEGPTASAVLGDICDLARGSRLATFGQPATSLENAPAAQTSLAAPHYLRLALLDKPG
ALAKVAAALGNAGISIDRMRQYGHSEPTAPVLIVTHKCTSSTLQTALEDLAKTDVVAGEP
VALRIEEV