Protein Info for PGA1_c08640 in Phaeobacter inhibens DSM 17395

Annotation: fructose-1,6-bisphosphatase class 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00330: fructose-1,6-bisphosphatase, class II
  • amino acids 13 to 318 (306 residues), 319.3 bits, E=1.5e-99
• PF03320: FBPase_glpX
  • amino acids 15 to 318 (304 residues), 434.8 bits, E=7.1e-135

Best Hits

Swiss-Prot: 47% identical to GLPX_CORGL: Fructose-1,6-bisphosphatase class 2 (glpX) from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

KEGG orthology group: K02446, fructose-1,6-bisphosphatase II [EC: 3.1.3.11] (inferred from 95% identity to sit:TM1040_2165)

Predicted SEED Role

"Fructose-1,6-bisphosphatase, GlpX type (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

• gluconeogenesis I (12/13 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• oxygenic photosynthesis (11/17 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

See I7DYP2 at UniProt or InterPro

Protein Sequence (327 amino acids)

>PGA1_c08640 fructose-1,6-bisphosphatase class 2 (Phaeobacter inhibens DSM 17395)
MTSDTNDAAFNDRLLSLGLARVAEQAALASAPLIGRGDEKAADQAAVNAMREQLNLLDIA
GVVVIGEGERDEAPMLFIGEEVGTGKGPGVDIALDPLEGTTLTAKDMPNALTVIAMGPRG
SMLHAPDTYMDKLAVGPGLPENVVSLDMSPRERVEALAKAKGCAPSDITVCILERPRHEA
MIAEVRETGAAIRLITDGDVAGVMHCAESEITGIDMYMGQGGAPEGVLAAAALKCMGGQI
FGRLLFRNDDEKARAAKAGITDLDRVYARDEMVTSDVIFAATGVTGGSLLPAIKRQPGWV
ETTTLLMRSKTGSVRRMSYRTPLSAHQ