Protein Info for Psest_0085 in Pseudomonas stutzeri RCH2

Updated annotation (from data): alpha-ketoglutarate TRAP transporter, solute receptor component
Rationale: specific phenotype on a-ketoglutarate and no other transporter for this substrate is apparent in the fitness data. (Mutants in another TRAP system, Psest_4268:Psest_4270, have a much milder defect in a-ketoglutarate utilization).
Original annotation: TRAP transporter solute receptor, TAXI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02122: TRAP transporter solute receptor, TAXI family" amino acids 5 to 314 (310 residues), 393.1 bits, see alignment E=3.7e-122 PF16868: NMT1_3" amino acids 31 to 314 (284 residues), 331.9 bits, see alignment E=6.5e-103 PF09084: NMT1" amino acids 46 to 191 (146 residues), 29.6 bits, see alignment E=1e-10 PF12974: Phosphonate-bd" amino acids 72 to 190 (119 residues), 38 bits, see alignment E=1.9e-13

Best Hits

KEGG orthology group: K07080, (no description) (inferred from 97% identity to psa:PST_4124)

Predicted SEED Role

"TRAP transporter solute receptor, unknown substrate 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GD92 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Psest_0085 alpha-ketoglutarate TRAP transporter, solute receptor component (Pseudomonas stutzeri RCH2)
MRLTKRLGLLAAAAAFTASTAAVAAPTFINILTGGTSGVYYPIGVALSQQYNKIDGAKTS
VQATKASVENLNLLQAGRGELAFSLGDSVEDAWNGVEDAGFKAPLKRLRAIAGTYNNYIQ
IVASAESGIKTLDDLKGKRISVGAPKSGTELNARAIFKAAGLDYKDMGRVEFLPYAESVE
LIKNRQLDATLQSSGLGMAAIRDLASTMPVTFVEIPAEVVEKIESDAYLAGVIPAGTYDG
QDADVPTVAITNILVTHEKVSDEVAYQMTKLMFDNLAALGNAHSAAKDIKLENATKNLPI
PLHPGAERFYKEAGVLK