Protein Info for Psest_0859 in Pseudomonas stutzeri RCH2

Annotation: Maltoporin (phage lambda and maltose receptor)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF02264: LamB" amino acids 29 to 430 (402 residues), 429.2 bits, see alignment E=1.4e-132

Best Hits

KEGG orthology group: K02024, maltoporin (inferred from 98% identity to psa:PST_3490)

Predicted SEED Role

"Maltoporin (maltose/maltodextrin high-affinity receptor, phage lambda receptor protein)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI45 at UniProt or InterPro

Protein Sequence (430 amino acids)

>Psest_0859 Maltoporin (phage lambda and maltose receptor) (Pseudomonas stutzeri RCH2)
MKHTAHPSFARKPACLLAALLVSGPALAVDFHGYLRSGVGATAGGGDQACFQAAGAPAKY
RLGNECETYAEIGLGQEVWSEGNRSFYVDSMIAYRSDQGNDWEAGGTDTNGGENNPFDEA
GTTSIRQFNVVGKNLIPSLPGAAIWAGKRYYKRHDVHINDYYYWDVSGPGAGIEDIDLGF
AKASVAWIRNTDGDWVYQGSGTGTNLANDTLDFRLAEIDVNPGGKLEIGYDYGKANLTDE
QERDPGYQDQKGHLVTLEHTQSDWFGGYNKLALQYGTDGIIGSSGRNNTGNSDGKMFRLV
NQGVVGLTDNIEMMYVQIYEDRDFDNDSGQTWASFGVRPVYKWSDVMSTALEFGYDRVDP
QADGERSRDLKKLTLAQQWSAGNSFWARPQIRVFATYAKWDGGRYQAASESIDAGDDDGI
TFGVQAEAWW