Protein Info for Psest_0844 in Pseudomonas stutzeri RCH2

Annotation: High-affinity Fe2+/Pb2+ permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details PF03239: FTR1" amino acids 4 to 212 (209 residues), 88.2 bits, see alignment E=3.2e-29

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 94% identity to psa:PST_3505)

Predicted SEED Role

"High-affinity iron permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI30 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Psest_0844 High-affinity Fe2+/Pb2+ permease (Pseudomonas stutzeri RCH2)
MGQSMFIVWRESVEALLVIGILHAWLRQQPGAGNALRMLWAGVAAGLGLAAALGWGVLQA
GDWLAGSGGEWFQCAMLLVASMLILHMVGWMHQHGRTLKTSLQNSAAEKLSQGSGFGLLL
LAMLAVGREGSETVVFLYGIGNQQQGLDLTRFVIGGVLGFALALLSYAALQAGSRYVSWR
RFFQISEVMLLLLGGALLMAALDRFSGQLMGMDVPEVLYTVFGDPLWDTSALLDDGGALG
GTIAGLTGYRSMPSLAAAVVLGLYWLAAWAWLKPRAQVQLAARPA