Protein Info for Psest_0843 in Pseudomonas stutzeri RCH2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 63 to 88 (26 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 402 to 421 (20 residues), see Phobius details amino acids 433 to 452 (20 residues), see Phobius details PF12801: Fer4_5" amino acids 63 to 103 (41 residues), 41.2 bits, see alignment 6.3e-15 amino acids 149 to 181 (33 residues), 21.5 bits, see alignment (E = 9.4e-09)

Best Hits

KEGG orthology group: None (inferred from 98% identity to psa:PST_3506)

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHF9 at UniProt or InterPro

Protein Sequence (458 amino acids)

>Psest_0843 hypothetical protein (Pseudomonas stutzeri RCH2)
MIAQAPWLARLGDLLRQHAKAIRTLQWLVVGFYLTLLVIPAFLDLPPAQAGMLDNLTVLA
QFIFWGLWWPFVLLSMIFFGRLWCGVLCPEGSLSEWISWRGLNKRTPRWVRWSGWPTIAF
ILTTVYGQLISVYDYAQAALLILGGSTVAAMLVGFLYGRGKRVWCRHLCPVSGVFALLAR
LAPVHYKVDEQRWLENREPHLPTPNCAPLIDIRRMQGNSDCHACGRCSSQRGAVQLSARS
PNSEILIVGGQQQSDHWDSTLLLFGMIGLAMGAFQWTVSPWFITLKQAAAEWLVDRDIFW
PLEANAPWWLLTHYPQANDAFTWLDGAAILTYIFGASLLVGGALWLLLRAAVRVMRRGDN
VFQHLALALVPLGGAGLFLGLSATTVKLLRYEGFLLAWAQPARAALLIGAVAWSLYLAWN
VISRHGGNGLRRLLAFACVNAGCALVGYGWWLQFWGWS