Protein Info for Psest_0835 in Pseudomonas stutzeri RCH2

Annotation: Collagenase and related proteases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF01136: Peptidase_U32" amino acids 8 to 318 (311 residues), 221.6 bits, see alignment E=6.3e-70

Best Hits

Swiss-Prot: 62% identical to YHBU_ECOLI: Uncharacterized protease YhbU (yhbU) from Escherichia coli (strain K12)

KEGG orthology group: K08303, putative protease [EC: 3.4.-.-] (inferred from 99% identity to psa:PST_3513)

Predicted SEED Role

"FIG139552: Putative protease" in subsystem CBSS-214092.1.peg.3450

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFA0 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Psest_0835 Collagenase and related proteases (Pseudomonas stutzeri RCH2)
MHLVCPAGSLPALKAAVQQGADAIYVGFRDDTNARHFAGLNLDEKQLDKGLQLIREKGRQ
LYIAVNTYAEPEGWNRWQRAVDQAADMGVDALIAADPGVLGYASKRHPKLNLHLSVQGSA
TNAAALGFYQERYGISRAVLPRVLSLKQVKQVAASSPVPIEVFAFGSLCIMAEGRCHLSS
YLTGESPNLCGVCSPAKAVRWSEEPEGLTSRLNNVLIDRYAEGESAGYPTLCKGRFMVNG
QRFHALEEPTSLNTLDLIPELSAIGVTAMKIEGRQRSPAYVEQVTRVWRAALDSYLKAPQ
RYAVEPGWRQVLDGLSEGSQTTLGAYHRAWQ