Protein Info for HP15_790 in Marinobacter adhaerens HP15

Annotation: 23S rRNA 5-methyluridine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 4 to 44 (41 residues), 28.3 bits, 5.4e-10
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 8 to 426 (419 residues), 342.7 bits, E=1.6e-106
• PF05958: tRNA_U5-meth_tr
  • amino acids 150 to 433 (284 residues), 87.2 bits, E=4.6e-28
• PF01135: PCMT
  • amino acids 275 to 344 (70 residues), 27.9 bits, E=8e-10
• PF05175: MTS
  • amino acids 282 to 367 (86 residues), 23.1 bits, E=2.1e-08
• PF13847: Methyltransf_31
  • amino acids 288 to 365 (78 residues), 50.8 bits, E=5.9e-17
• PF03602: Cons_hypoth95
  • amino acids 288 to 379 (92 residues), 25.8 bits, E=3.1e-09
• PF13649: Methyltransf_25
  • amino acids 292 to 346 (55 residues), 33.4 bits, 2.4e-11

Best Hits

Swiss-Prot: 88% identical to RLMD_MARHV: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 88% identity to maq:Maqu_2239)

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See E4PQL1 at UniProt or InterPro

Protein Sequence (436 amino acids)

>HP15_790 23S rRNA 5-methyluridine methyltransferase (Marinobacter adhaerens HP15)
MRCEIETLSHDGRGIARQDGKTQFVDGALPGETVMAKVVSSRSKFDELRTEEVLDAAPGR
QTPPCEFADLCGGCSLQHMSGDAQIEFKENTLREHFAHFGGIEPEEWIAPLRSEESLGYR
RKARLGVRYVKARESVLVGFREKRNSFLTDIDRCVVLDPRIGERILPLRNMLHDLEAYSR
IPQVEIACGDDVAVMVFRNMDELSVGDREKLIAFGQAHELHIYLQPKGPDTVHRIWPESA
GRDEERLSYRLDEFDLTMRFHPMDFTQVNAGINRAMVHRAVEWLDVQPGERVLDLFCGLG
NFTLPLATRGGQVVGVEGDETMVVRGRENAELNGLDNVAFHGADLHGDFTGQSWAKEGFD
KILIDPPRSGAEEICKYLTAFGAQKIVYVSCNPATLARDAGVMVRNGYRLVRAGVMDMFP
HTTHVESIALFEKDSG