Protein Info for PGA1_c00830 in Phaeobacter inhibens DSM 17395

Annotation: putative threonine-phosphate decarboxylase CobC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details PF00155: Aminotran_1_2" amino acids 173 to 341 (169 residues), 68.6 bits, see alignment E=3e-23

Best Hits

KEGG orthology group: K02225, cobalamin biosynthetic protein CobC (inferred from 65% identity to sit:TM1040_2584)

Predicted SEED Role

"L-threonine 3-O-phosphate decarboxylase (EC 4.1.1.81)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 4.1.1.81)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.81

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWL9 at UniProt or InterPro

Protein Sequence (356 amino acids)

>PGA1_c00830 putative threonine-phosphate decarboxylase CobC (Phaeobacter inhibens DSM 17395)
MIPRRYGCFLAIAVPYGGIGSAYFWPSVLVHLLRPKMTGMLDLTEVPKRDHGGNLSAAIS
EFGGVASDWVDISTGINPVPYPVPDLTAADWGALPDQAAMTDLVTAARHFWNVPQEAAVL
AAPGASALIAAIPALADPRWVQITPPTYNEHAAAFAARGWQTVTAGPAEACVLVHPNNPD
GRRWSAEDVQAPLVVIDESFCDVCPADSLIHLANRPGVVILKSFGKFWGLAGLRLGFAIG
DPSLIGNLAAWQGPWAVSGPALRIGAQALRDADWAETTRARLQQDAKRLDKMVTGKGAKL
VGGTDLFRLYDVDDAAAWQARLASAQIWTRIFPYSKTYLRLGLPTGEGWERLEAAL