Protein Info for Psest_0819 in Pseudomonas stutzeri RCH2

Annotation: Cytochrome c551/c552

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 21 to 100 (80 residues), 38.5 bits, see alignment E=1.2e-13 PF00034: Cytochrom_C" amino acids 22 to 104 (83 residues), 44 bits, see alignment E=4.9e-15

Best Hits

Swiss-Prot: 96% identical to CY551_PSEST: Cytochrome c-551 (nirM) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 88% identity to psa:PST_3529)

Predicted SEED Role

"Cytochrome c551 NirM" in subsystem Dissimilatory nitrite reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI02 at UniProt or InterPro

Protein Sequence (104 amino acids)

>Psest_0819 Cytochrome c551/c552 (Pseudomonas stutzeri RCH2)
MKKILIPMLALGGALTLQPALAQDGEALFKSKPCAACHSVDTKMVGPALKEVAAKNAGVE
GAADTLAQHIKNGSQGVWGPIPMPPNPVTEEEAKTLAEWVLSLK