Protein Info for HP15_782 in Marinobacter adhaerens HP15

Annotation: signal peptidase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 66 to 83 (18 residues), see Phobius details PF10502: Peptidase_S26" amino acids 62 to 250 (189 residues), 190.8 bits, see alignment E=9.2e-61 TIGR02227: signal peptidase I" amino acids 66 to 251 (186 residues), 168.5 bits, see alignment E=5.6e-54

Best Hits

Swiss-Prot: 59% identical to LEP_PSEAE: Signal peptidase I (lepB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03100, signal peptidase I [EC: 3.4.21.89] (inferred from 80% identity to maq:Maqu_2247)

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQK3 at UniProt or InterPro

Protein Sequence (268 amino acids)

>HP15_782 signal peptidase I (Marinobacter adhaerens HP15)
MDIDFPLVLVVLTFATGLIWLADKLFLRERRLAAYRASGTGDAVDEGSPAESEEPKEPYL
VDLSRSFFPVLAIVLVLRSFLVEPFQIPSGSMLPTLEVGDFILVNKYAYGFRLPVAGTKV
IPVGDPQRGDVMVFRYPEDGQTNYIKRVIGLPGDHIRYRDKQLFINGDRVETRFIARLPP
MELRREDLGEVEHDIFLTMGRSGGGGEGEWLVPEGHYFVMGDNRDNSNDSRYWGTVPDEL
VVGKAFAIWMHWKSLTSLPSFDRVGGIE