Protein Info for HP15_781 in Marinobacter adhaerens HP15

Annotation: GTP-binding protein LepA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 PF00009: GTP_EFTU" amino acids 6 to 185 (180 residues), 182.5 bits, see alignment E=1.6e-57 TIGR01393: elongation factor 4" amino acids 6 to 599 (594 residues), 972.4 bits, see alignment E=7.8e-297 TIGR00231: small GTP-binding protein domain" amino acids 8 to 174 (167 residues), 59.7 bits, see alignment E=2.9e-20 PF00071: Ras" amino acids 55 to 183 (129 residues), 24.4 bits, see alignment E=5e-09 PF03144: GTP_EFTU_D2" amino acids 208 to 277 (70 residues), 35.3 bits, see alignment E=3.3e-12 PF00679: EFG_C" amino acids 403 to 488 (86 residues), 68.5 bits, see alignment E=1e-22 PF06421: LepA_C" amino acids 491 to 597 (107 residues), 166.2 bits, see alignment E=5.2e-53

Best Hits

Swiss-Prot: 96% identical to LEPA_MARHV: Elongation factor 4 (lepA) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03596, GTP-binding protein LepA (inferred from 96% identity to maq:Maqu_2248)

Predicted SEED Role

"Translation elongation factor LepA" in subsystem Heat shock dnaK gene cluster extended or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQK2 at UniProt or InterPro

Protein Sequence (600 amino acids)

>HP15_781 GTP-binding protein LepA (Marinobacter adhaerens HP15)
MTELSRIRNFSIIAHIDHGKSTLADRFIQVCGGLTDREMAEQVLDSMDLERERGITIKAQ
SVTLNYTARDGQEYKLNFIDTPGHVDFSYEVSRSLYACEGALLVVDAGQGVEAQSVANCY
TAIEQGLEVVPVLNKMDLPQAEPERVAAEIEDIIGIEASDAVRCSAKSGLGVEDVLEDLI
KKIPPPKGDRSAPLQALIIDSWFDNYLGVVSLVRVTEGTLKKGDKIVIKSTGKAWNADKV
GIFNPKPKDTDLLESGDVGFVVAGIKDIHGAPVGDTIVHQKFAEQTPMLPGFKKVKPQVY
AGLFPVSADDYNDFRDALEKLTLNDASLFFEPENSDALGFGFRCGFLGMLHMEIIQERLE
REYDIDLITTAPTVIYEVVTKQGETLSVDNPSRLPDIGSIEEMREPIVEANILVPQEHIG
NVIALCEEKRGVQKNMHFMTTQVQLTYELPMAEVVMDFFDRIKSASRGFASLDYHFTRFQ
TANLVRLDVLINGERVDALALIVHKEQAHHKGRQLIEKMKELIPRQMFDIAIQAAIGNQV
VSRVTVKALRKNVTAKCYGGDVSRKKKLLQKQKEGKKRMKQLGNVEVPQEAFLAVLKVDK