Protein Info for Psest_0813 in Pseudomonas stutzeri RCH2

Annotation: Heme/copper-type cytochrome/quinol oxidase, subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details PF00510: COX3" amino acids 19 to 193 (175 residues), 59.5 bits, see alignment E=2.4e-20

Best Hits

KEGG orthology group: K02164, nitric oxide reductase NorE protein (inferred from 90% identity to psa:PST_3534)

Predicted SEED Role

"Nitric oxide reductase activation protein NorE" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHC9 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Psest_0813 Heme/copper-type cytochrome/quinol oxidase, subunit 3 (Pseudomonas stutzeri RCH2)
MSTSADTFSSPTRRLPGDLAMWFFILAELTVFAILILAFAVAQMVYPEQFDESRAALDSP
IGLALTLSLLTSGLFAALAVEQVRQARSARATLLLLAALGSSCVYVVLKLNEYGHLAGLG
LGMEHNTFFTLYWILTGFHFLHVLLGMVILGWLAMRCRRGAYGPDNHSGLESGVLYWHMV
DMVWVLLFPLVYVLR