Protein Info for HP15_773 in Marinobacter adhaerens HP15
Annotation: conserved hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 66% identical to SDHE_PSEAE: FAD assembly factor SdhE (sdhE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K09159, hypothetical protein (inferred from 74% identity to maq:Maqu_2265)Predicted SEED Role
"YgfY COG2938"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PQJ4 at UniProt or InterPro
Protein Sequence (90 amino acids)
>HP15_773 conserved hypothetical protein (Marinobacter adhaerens HP15) MSETPASSEKAEFNRLWWHSRRGMLELDNLLIPFMEEAFRDLDAEDQARYKKLLTCEDND MFEWFMQRSRPADPDLQRMVDIILKRVQPD